Lineage for d2ys7a3 (2ys7 A:323-418)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817437Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2817540Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) (S)
  5. 2817665Family b.84.2.0: automated matches [254217] (1 protein)
    not a true family
  6. 2817666Protein automated matches [254496] (16 species)
    not a true protein
  7. 2817687Species Geobacillus kaustophilus [TaxId:1462] [255711] (4 PDB entries)
  8. 2817689Domain d2ys7a3: 2ys7 A:323-418 [244817]
    Other proteins in same PDB: d2ys7a1, d2ys7a2, d2ys7a4
    automated match to d1gsoa1

Details for d2ys7a3

PDB Entry: 2ys7 (more details), 2.21 Å

PDB Description: Crystal structure of GAR synthetase from Geobacillus kaustophilus
PDB Compounds: (A:) Phosphoribosylglycinamide synthetase

SCOPe Domain Sequences for d2ys7a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ys7a3 b.84.2.0 (A:323-418) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
deavlgvvlaakgypgayergaeirgldrispdallfhagtkreggawytnggrvlllaa
kgetlakakekayeqlaaidcdglfyrrdigrraie

SCOPe Domain Coordinates for d2ys7a3:

Click to download the PDB-style file with coordinates for d2ys7a3.
(The format of our PDB-style files is described here.)

Timeline for d2ys7a3: