| Class b: All beta proteins [48724] (180 folds) |
| Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) ![]() |
| Family b.84.2.0: automated matches [254217] (1 protein) not a true family |
| Protein automated matches [254496] (16 species) not a true protein |
| Species Geobacillus kaustophilus [TaxId:1462] [255711] (4 PDB entries) |
| Domain d2ys6a3: 2ys6 A:323-418 [244814] Other proteins in same PDB: d2ys6a1, d2ys6a2, d2ys6a4 automated match to d1gsoa1 complexed with amp, gly |
PDB Entry: 2ys6 (more details), 2.21 Å
SCOPe Domain Sequences for d2ys6a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ys6a3 b.84.2.0 (A:323-418) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
deavlgvvlaakgypgayergaeirgldrispdallfhagtkreggawytnggrvlllaa
kgetlakakekayeqlaaidcdglfyrrdigrraie
Timeline for d2ys6a3: