| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
| Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
| Protein Integrin beta-4 subunit [49278] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49279] (3 PDB entries) |
| Domain d2yrza1: 2yrz A:8-112 [244810] Other proteins in same PDB: d2yrza2, d2yrza3 automated match to d1x5fa1 |
PDB Entry: 2yrz (more details)
SCOPe Domain Sequences for d2yrza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yrza1 b.1.2.1 (A:8-112) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]}
shdsrltagvpdtptrlvfsalgptslrvswqeprcerplqgysveyqllnggelhrlni
pnpaqtsvvvedllpnhsyvfrvraqsqegwgreregvitiesqv
Timeline for d2yrza1: