Lineage for d2yrza1 (2yrz A:8-112)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2761968Protein Integrin beta-4 subunit [49278] (1 species)
  7. 2761969Species Human (Homo sapiens) [TaxId:9606] [49279] (3 PDB entries)
  8. 2761978Domain d2yrza1: 2yrz A:8-112 [244810]
    Other proteins in same PDB: d2yrza2, d2yrza3
    automated match to d1x5fa1

Details for d2yrza1

PDB Entry: 2yrz (more details)

PDB Description: solution structure of the fibronectin type iii domain of human integrin beta-4
PDB Compounds: (A:) Integrin beta-4

SCOPe Domain Sequences for d2yrza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yrza1 b.1.2.1 (A:8-112) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]}
shdsrltagvpdtptrlvfsalgptslrvswqeprcerplqgysveyqllnggelhrlni
pnpaqtsvvvedllpnhsyvfrvraqsqegwgreregvitiesqv

SCOPe Domain Coordinates for d2yrza1:

Click to download the PDB-style file with coordinates for d2yrza1.
(The format of our PDB-style files is described here.)

Timeline for d2yrza1: