![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (13 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.2: SH3-domain [50044] (1 family) ![]() |
![]() | Family b.34.2.1: SH3-domain [50045] (26 proteins) |
![]() | Protein Abl tyrosine kinase, SH3 domain [50052] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50054] (4 PDB entries) |
![]() | Domain d2abl_1: 2abl 75-139 [24481] Other proteins in same PDB: d2abl_2 mutant |
PDB Entry: 2abl (more details), 2.5 Å
SCOP Domain Sequences for d2abl_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2abl_1 b.34.2.1 (75-139) Abl tyrosine kinase, SH3 domain {Human (Homo sapiens)} mgpsendpnlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsny itpvn
Timeline for d2abl_1: