Lineage for d2abl_1 (2abl 75-139)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 227526Fold b.34: SH3-like barrel [50036] (12 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 227568Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 227569Family b.34.2.1: SH3-domain [50045] (24 proteins)
  6. 227573Protein Abl tyrosine kinase, SH3 domain [50052] (2 species)
  7. 227574Species Human (Homo sapiens) [TaxId:9606] [50054] (4 PDB entries)
  8. 227579Domain d2abl_1: 2abl 75-139 [24481]
    Other proteins in same PDB: d2abl_2
    mutant

Details for d2abl_1

PDB Entry: 2abl (more details), 2.5 Å

PDB Description: sh3-sh2 domain fragment of human bcr-abl tyrosine kinase

SCOP Domain Sequences for d2abl_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2abl_1 b.34.2.1 (75-139) Abl tyrosine kinase, SH3 domain {Human (Homo sapiens)}
mgpsendpnlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsny
itpvn

SCOP Domain Coordinates for d2abl_1:

Click to download the PDB-style file with coordinates for d2abl_1.
(The format of our PDB-style files is described here.)

Timeline for d2abl_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2abl_2