SCOPe 2.06: Domain d2yrwa2: 2yrw A:102-322

Lineage for d2yrwa2 (2yrw A:102-322)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families)

5. Family d.142.1.0: automated matches [227184] (1 protein)
   not a true family

6. Protein automated matches [226904] (32 species)
   not a true protein

7. Species Geobacillus kaustophilus [TaxId:1462] [255710] (4 PDB entries)

8. Domain d2yrwa2: 2yrw A:102-322 [244804]
   Other proteins in same PDB: d2yrwa1, d2yrwa3, d2yrwa4
   automated match to d1gsoa3
   complexed with po4

Details for d2yrwa2

PDB Entry: 2yrw, 2.2 Å

PDB Description: Crystal structure of GAR synthetase from Geobacillus kaustophilus

PDB Compounds: (A:) Phosphoribosylglycinamide synthetase

SCOPe Domain Sequences for d2yrwa2:

Sequence, based on SEQRES records:

>d2yrwa2 d.142.1.0 (A:102-322) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
skafakelmkkygiptadhaaftsyeeakayieqkgapivikadglaagkgvtvaqtvee
alaaakaalvdgqfgtagsqvvieeylegeefsfmafvngekvyplaiaqdhkraydgde
gpntggmgayspvpqisdemmdaaleailrpaakalaaegrpflgvlyaglmatangpkv
iefnarfgdpeaqvvlprlktdlveavlavmdgkelelewt

Sequence, based on observed residues (ATOM records):

>d2yrwa2 d.142.1.0 (A:102-322) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
skafakelmkkygiptadhaaftsyeeakayieqkgapivikadgvtvaqtveealaaak
aalvdgqfgtagsqvvieeylegeefsfmafvngekvyplaiaqdhkraydgdegpntgg
mgayspvpqisdemmdaaleailrpaakalaaegrpflgvlyaglmatangpkviefnar
fgdpeaqvvlprlktdlveavlavmdgkelelewt

Timeline for d2yrwa2:

• d2yrwa2 first appeared in SCOPe 2.04
  
• d2yrwa2 appears in SCOPe 2.05
  
• d2yrwa2 appears in SCOPe 2.07
  
• d2yrwa2 appears in the current release, SCOPe 2.08