Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.6: Cadherin-like [49313] (3 families) |
Family b.1.6.0: automated matches [191376] (1 protein) not a true family |
Protein automated matches [190458] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255601] (3 PDB entries) |
Domain d2yqga_: 2yqg A: [244798] automated match to d2omxb_ |
PDB Entry: 2yqg (more details)
SCOPe Domain Sequences for d2yqga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yqga_ b.1.6.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gssgssgqkrawitapvalregedlskknpiakihsdlaeerglkitykytgkgiteppf gifvfnkdtgelnvtsildreetpfflltgyaldargnnvekplelrikvldindnepvf tqd
Timeline for d2yqga_: