Lineage for d2yqga_ (2yqg A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1768942Superfamily b.1.6: Cadherin-like [49313] (3 families) (S)
  5. 1769032Family b.1.6.0: automated matches [191376] (1 protein)
    not a true family
  6. 1769033Protein automated matches [190458] (4 species)
    not a true protein
  7. 1769048Species Human (Homo sapiens) [TaxId:9606] [255601] (3 PDB entries)
  8. 1769052Domain d2yqga_: 2yqg A: [244798]
    automated match to d2omxb_

Details for d2yqga_

PDB Entry: 2yqg (more details)

PDB Description: solution structure of the first cadherin domain from human desmoglein- 2
PDB Compounds: (A:) Desmoglein-2

SCOPe Domain Sequences for d2yqga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yqga_ b.1.6.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgqkrawitapvalregedlskknpiakihsdlaeerglkitykytgkgiteppf
gifvfnkdtgelnvtsildreetpfflltgyaldargnnvekplelrikvldindnepvf
tqd

SCOPe Domain Coordinates for d2yqga_:

Click to download the PDB-style file with coordinates for d2yqga_.
(The format of our PDB-style files is described here.)

Timeline for d2yqga_: