SCOPe 2.08: Domain d2yqga1: 2yqg A:8-123

Lineage for d2yqga1 (2yqg A:8-123)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.6: Cadherin-like [49313] (4 families)

5. Family b.1.6.0: automated matches [191376] (1 protein)
   not a true family

6. Protein automated matches [190458] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255601] (21 PDB entries)

8. Domain d2yqga1: 2yqg A:8-123 [244798]
   Other proteins in same PDB: d2yqga2
   automated match to d2omxb_

Details for d2yqga1

PDB Entry: 2yqg

PDB Description: solution structure of the first cadherin domain from human desmoglein- 2

PDB Compounds: (A:) Desmoglein-2

SCOPe Domain Sequences for d2yqga1:

Sequence; same for both SEQRES and ATOM records:

>d2yqga1 b.1.6.0 (A:8-123) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qkrawitapvalregedlskknpiakihsdlaeerglkitykytgkgiteppfgifvfnk
dtgelnvtsildreetpfflltgyaldargnnvekplelrikvldindnepvftqd

Timeline for d2yqga1:

• d2yqga1 first appeared in SCOPe 2.04, called d2yqga_
  
• d2yqga1 appears in SCOPe 2.07