Lineage for d2yqda1 (2yqd A:8-120)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319937Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2319938Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2320170Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2320171Protein automated matches [190615] (14 species)
    not a true protein
  7. 2321483Species Mouse (Mus musculus) [TaxId:10090] [196526] (5 PDB entries)
  8. 2321488Domain d2yqda1: 2yqd A:8-120 [244797]
    Other proteins in same PDB: d2yqda2
    automated match to d3g0ja_

Details for d2yqda1

PDB Entry: 2yqd (more details)

PDB Description: solution structure of the fifth bromodomain from mouse polybromo-1
PDB Compounds: (A:) polybromo-1

SCOPe Domain Sequences for d2yqda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yqda1 a.29.2.0 (A:8-120) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kkskymtpmqqklnevyeavknytdkrgrrlsaiflrlpsrselpdyyltikkpmdmeki
rshmmankyqdidsmvedfvmmfnnactynepesliykdalvlhkvlletrrd

SCOPe Domain Coordinates for d2yqda1:

Click to download the PDB-style file with coordinates for d2yqda1.
(The format of our PDB-style files is described here.)

Timeline for d2yqda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2yqda2