SCOPe 2.08: Domain d2yqda1: 2yqd A:8-120

Lineage for d2yqda1 (2yqd A:8-120)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [196526] (5 PDB entries)

8. Domain d2yqda1: 2yqd A:8-120 [244797]
   Other proteins in same PDB: d2yqda2
   automated match to d3g0ja_

Details for d2yqda1

PDB Entry: 2yqd

PDB Description: solution structure of the fifth bromodomain from mouse polybromo-1

PDB Compounds: (A:) polybromo-1

SCOPe Domain Sequences for d2yqda1:

Sequence; same for both SEQRES and ATOM records:

>d2yqda1 a.29.2.0 (A:8-120) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kkskymtpmqqklnevyeavknytdkrgrrlsaiflrlpsrselpdyyltikkpmdmeki
rshmmankyqdidsmvedfvmmfnnactynepesliykdalvlhkvlletrrd

Timeline for d2yqda1:

• d2yqda1 first appeared in SCOPe 2.04, called d2yqda_
  
• d2yqda1 appears in SCOPe 2.07