Lineage for d2ypdb1 (2ypd B:2157-2497)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070786Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2071232Family b.82.2.0: automated matches [191672] (1 protein)
    not a true family
  6. 2071233Protein automated matches [191281] (13 species)
    not a true protein
  7. 2071254Species Human (Homo sapiens) [TaxId:9606] [255708] (2 PDB entries)
  8. 2071256Domain d2ypdb1: 2ypd B:2157-2497 [244796]
    Other proteins in same PDB: d2ypda2, d2ypdb2
    automated match to d4c8da_
    complexed with emt, na

Details for d2ypdb1

PDB Entry: 2ypd (more details), 2.1 Å

PDB Description: Crystal structure of the Jumonji domain of human Jumonji domain containing 1C protein
PDB Compounds: (B:) probable jmjc domain-containing histone demethylation prot ein 2c

SCOPe Domain Sequences for d2ypdb1:

Sequence, based on SEQRES records: (download)

>d2ypdb1 b.82.2.0 (B:2157-2497) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iphswicekhilwlkdyknssnwklfkecwkqgqpavvsgvhkkmnislwkaesisldfg
dhqadllnckdsiisnanvkefwdgfeevskrqknksgetvvlklkdwpsgedfktmmpa
ryedllkslplpeycnpegkfnlashlpgffvrpdlgprlcsaygvvaakdhdigttnlh
ievsdvvnilvyvgiakgngilskagilkkfeeedlddilrkrlkdsseipgalwhiyag
kdvdkireflqkiskeqglevlpehdpirdqswyvnkklrqrlleeygvrtctliqflgd
aivlpagalhqvqnfhsciqvtedfvspehlvesfhltqel

Sequence, based on observed residues (ATOM records): (download)

>d2ypdb1 b.82.2.0 (B:2157-2497) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iphswicekhilwlkdyknssnwklfkecwkqgqpavvsgvhkkmnislwkaesisldfg
dhqadllnckdsiisnanvkefwdgfeevskretvvlklkdwpsgedfktmmparyedll
kslplpeycnpegkfnlashlpgffvgprlcsaygvvaakdhdigttnlhievsdvvnil
vyvgiakgngilskagilkkfeeedlddilrkrlkdsseipgalwhiyagkdvdkirefl
qkiskeqghdpirdqswyvnkklrqrlleeygvrtctliqflgdaivlpagalhqvqnfh
sciqvtedfvspehlvesfhltqel

SCOPe Domain Coordinates for d2ypdb1:

Click to download the PDB-style file with coordinates for d2ypdb1.
(The format of our PDB-style files is described here.)

Timeline for d2ypdb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ypdb2