Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (147 species) not a true protein |
Species Streptococcus pneumoniae [TaxId:170187] [255707] (3 PDB entries) |
Domain d2yp6d_: 2yp6 D: [244794] automated match to d4nmud_ complexed with c6w, mli |
PDB Entry: 2yp6 (more details), 1.77 Å
SCOPe Domain Sequences for d2yp6d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yp6d_ c.47.1.0 (D:) automated matches {Streptococcus pneumoniae [TaxId: 170187]} iavgkdapdftlqsmdgkevklsdfkgkkvylkfwaswcgpckksmpelmelaakpdrdf eiltviapgiqgektveqfpqwfqeqgykdipvlydtkattfqayqirsipteylidsqg kigkiqfgaisnadaeaafkemn
Timeline for d2yp6d_: