Lineage for d2yp6d_ (2yp6 D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1854430Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1854431Protein automated matches [190056] (147 species)
    not a true protein
  7. 1855475Species Streptococcus pneumoniae [TaxId:170187] [255707] (3 PDB entries)
  8. 1855482Domain d2yp6d_: 2yp6 D: [244794]
    automated match to d4nmud_
    complexed with c6w, mli

Details for d2yp6d_

PDB Entry: 2yp6 (more details), 1.77 Å

PDB Description: Crystal structure of the pneumoccocal exposed lipoprotein thioredoxin sp_1000 (Etrx2) from Streptococcus pneumoniae strain TIGR4 in complex with Cyclofos 3 TM
PDB Compounds: (D:) Thioredoxin family protein

SCOPe Domain Sequences for d2yp6d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yp6d_ c.47.1.0 (D:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
iavgkdapdftlqsmdgkevklsdfkgkkvylkfwaswcgpckksmpelmelaakpdrdf
eiltviapgiqgektveqfpqwfqeqgykdipvlydtkattfqayqirsipteylidsqg
kigkiqfgaisnadaeaafkemn

SCOPe Domain Coordinates for d2yp6d_:

Click to download the PDB-style file with coordinates for d2yp6d_.
(The format of our PDB-style files is described here.)

Timeline for d2yp6d_: