![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
![]() | Protein automated matches [190123] (158 species) not a true protein |
![]() | Species Prochlorococcus marinus [TaxId:1219] [255706] (1 PDB entry) |
![]() | Domain d2ynma_: 2ynm A: [244789] automated match to d1cp2a_ complexed with 1pe, adp, af3, epe, gol, k, mg, pmr, sf4 |
PDB Entry: 2ynm (more details), 2.1 Å
SCOPe Domain Sequences for d2ynma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ynma_ c.37.1.0 (A:) automated matches {Prochlorococcus marinus [TaxId: 1219]} alviavygkggigksttssnlsaafsklgkkvlqigcdpkhdstftlthkmvptvidile evdfhseelrpqdfmfegfngvqcvesggppagtgcggyvtgqtvkllkehhlledtdvv ifdvlgdvvcggfaaplqhanyclivtandfdsifamnrivaainakaknykvrlggvia nrsaeldqiekfnektglktmahfrnvdairrsrlkkctifemdpeeegvlevqneylsl akkmidnvepleaeplkdreifdllgf
Timeline for d2ynma_: