Lineage for d2ymub2 (2ymu B:291-577)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1803012Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 1803160Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 1803303Family b.69.4.0: automated matches [191412] (1 protein)
    not a true family
  6. 1803304Protein automated matches [190568] (5 species)
    not a true protein
  7. 1803392Species Nostoc punctiforme [TaxId:272131] [255705] (1 PDB entry)
  8. 1803396Domain d2ymub2: 2ymu B:291-577 [244788]
    automated match to d1p22a2

Details for d2ymub2

PDB Entry: 2ymu (more details), 1.79 Å

PDB Description: Structure of a highly repetitive propeller structure
PDB Compounds: (B:) wd-40 repeat protein

SCOPe Domain Sequences for d2ymub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ymub2 b.69.4.0 (B:291-577) automated matches {Nostoc punctiforme [TaxId: 272131]}
rngqllqtltghsssvwgvafspdgqtiasasddktvklwnrngqhlqtltghsssvwgv
afspdgqtiasasddktvklwnrngqllqtltghsssvrgvafspdgqtiasasddktvk
lwnrngqllqtltghsssvwgvafspddqtiasasddktvklwnrngqllqtltghsssv
rgvafspdgqtiasasddktvklwnrngqllqtltghsssvrgvafspdgqtiasasddk
tvklwnrngqllqtltghsssvwgvafspdgqtiasassdktvklwn

SCOPe Domain Coordinates for d2ymub2:

Click to download the PDB-style file with coordinates for d2ymub2.
(The format of our PDB-style files is described here.)

Timeline for d2ymub2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ymub1