Lineage for d2ymub1 (2ymu B:1-290)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1554689Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 1554832Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 1554967Family b.69.4.0: automated matches [191412] (1 protein)
    not a true family
  6. 1554968Protein automated matches [190568] (4 species)
    not a true protein
  7. 1555028Species Nostoc punctiforme [TaxId:272131] [255705] (1 PDB entry)
  8. 1555031Domain d2ymub1: 2ymu B:1-290 [244787]
    automated match to d1p22a2

Details for d2ymub1

PDB Entry: 2ymu (more details), 1.79 Å

PDB Description: Structure of a highly repetitive propeller structure
PDB Compounds: (B:) wd-40 repeat protein

SCOPe Domain Sequences for d2ymub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ymub1 b.69.4.0 (B:1-290) automated matches {Nostoc punctiforme [TaxId: 272131]}
gshmgvkernrleahsssvrgvafspdgqtiasasddktvklwnrngqllqtltghsssv
wgvafspdgqtiasasddktvklwnrngqllqtltghsssvrgvafspdgqtiasasddk
tvklwnrngqllqtltghsssvwgvafspdgqtiasasddktvklwnrngqllqtltghs
ssvwgvafspdgqtiasasddktvklwnrngqllqtltghsssvrgvafspdgqtiasas
ddktvklwnrngqllqtltghsssvngvafrpdgqtiasasddktvklwn

SCOPe Domain Coordinates for d2ymub1:

Click to download the PDB-style file with coordinates for d2ymub1.
(The format of our PDB-style files is described here.)

Timeline for d2ymub1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ymub2