Lineage for d2ymua2 (2ymu A:291-577)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2808719Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2808917Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2809156Family b.69.4.0: automated matches [191412] (1 protein)
    not a true family
  6. 2809157Protein automated matches [190568] (11 species)
    not a true protein
  7. 2809354Species Nostoc punctiforme [TaxId:272131] [255705] (1 PDB entry)
  8. 2809356Domain d2ymua2: 2ymu A:291-577 [244786]
    Other proteins in same PDB: d2ymua3, d2ymub3
    automated match to d1p22a2

Details for d2ymua2

PDB Entry: 2ymu (more details), 1.79 Å

PDB Description: Structure of a highly repetitive propeller structure
PDB Compounds: (A:) wd-40 repeat protein

SCOPe Domain Sequences for d2ymua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ymua2 b.69.4.0 (A:291-577) automated matches {Nostoc punctiforme [TaxId: 272131]}
rngqllqtltghsssvwgvafspdgqtiasasddktvklwnrngqhlqtltghsssvwgv
afspdgqtiasasddktvklwnrngqllqtltghsssvrgvafspdgqtiasasddktvk
lwnrngqllqtltghsssvwgvafspddqtiasasddktvklwnrngqllqtltghsssv
rgvafspdgqtiasasddktvklwnrngqllqtltghsssvrgvafspdgqtiasasddk
tvklwnrngqllqtltghsssvwgvafspdgqtiasassdktvklwn

SCOPe Domain Coordinates for d2ymua2:

Click to download the PDB-style file with coordinates for d2ymua2.
(The format of our PDB-style files is described here.)

Timeline for d2ymua2: