Lineage for d2ym9c_ (2ym9 C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2738288Fold a.250: IpaD-like [140692] (1 superfamily)
    6 helices; bundle, up-and-down; can be divided into two four-helical bundles sharing two helices (3 and 6), which are twice longer than the rest
  4. 2738289Superfamily a.250.1: IpaD-like [140693] (2 families) (S)
  5. 2738321Family a.250.1.0: automated matches [254281] (1 protein)
    not a true family
  6. 2738322Protein automated matches [254655] (2 species)
    not a true protein
  7. 2738323Species Salmonella enterica [TaxId:216597] [255704] (2 PDB entries)
  8. 2738324Domain d2ym9c_: 2ym9 C: [244784]
    automated match to d2jaaa1
    complexed with gol, so4

Details for d2ym9c_

PDB Entry: 2ym9 (more details), 3 Å

PDB Description: SipD from Salmonella typhimurium
PDB Compounds: (C:) Cell invasion protein sipD

SCOPe Domain Sequences for d2ym9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ym9c_ a.250.1.0 (C:) automated matches {Salmonella enterica [TaxId: 216597]}
tisdaeiwdmvsqnisaigdsylgvyenvvavytdfyqafsdilskmggwllpgkdgntv
kldvtslkndlnslvnkynqinsntvlfpaqsgsgvkvateaearqwlselnlpnsclks
ygsgyvvtvdltplqkmvqdidglgapgkdsklemdnakyqawqsgfkaqeenmkttlqt
ltqkysnanslydnlvkvlsstisssletaksflqg

SCOPe Domain Coordinates for d2ym9c_:

Click to download the PDB-style file with coordinates for d2ym9c_.
(The format of our PDB-style files is described here.)

Timeline for d2ym9c_: