Class a: All alpha proteins [46456] (290 folds) |
Fold a.250: IpaD-like [140692] (1 superfamily) 6 helices; bundle, up-and-down; can be divided into two four-helical bundles sharing two helices (3 and 6), which are twice longer than the rest |
Superfamily a.250.1: IpaD-like [140693] (2 families) |
Family a.250.1.0: automated matches [254281] (1 protein) not a true family |
Protein automated matches [254655] (2 species) not a true protein |
Species Salmonella enterica [TaxId:216597] [255704] (2 PDB entries) |
Domain d2ym0b1: 2ym0 B:132-330 [244783] Other proteins in same PDB: d2ym0a2, d2ym0b2 automated match to d2jaaa1 complexed with gol |
PDB Entry: 2ym0 (more details), 3 Å
SCOPe Domain Sequences for d2ym0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ym0b1 a.250.1.0 (B:132-330) automated matches {Salmonella enterica [TaxId: 216597]} aeiwdmvsqnisaigdsylgvyenvvavytdfyqafsdilskmggwllpgkdgntvkldv tslkndlnslvnkynqinsntvlfpaqsgsgvkvateaearqwlselnlpnsclksygsg yvvtvdltplqkmvqdidglgapgkdsklemdnakyqawqsgfkaqeenmkttlqtltqk ysnanslydnlvkvlssti
Timeline for d2ym0b1: