SCOPe 2.07: Domain d2ym0a1: 2ym0 A:132-329

Lineage for d2ym0a1 (2ym0 A:132-329)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.250: IpaD-like [140692] (1 superfamily)
   6 helices; bundle, up-and-down; can be divided into two four-helical bundles sharing two helices (3 and 6), which are twice longer than the rest

4. Superfamily a.250.1: IpaD-like [140693] (2 families)

5. Family a.250.1.0: automated matches [254281] (1 protein)
   not a true family

6. Protein automated matches [254655] (2 species)
   not a true protein

7. Species Salmonella enterica [TaxId:216597] [255704] (2 PDB entries)

8. Domain d2ym0a1: 2ym0 A:132-329 [244782]
   Other proteins in same PDB: d2ym0a2, d2ym0b2
   automated match to d2jaaa1
   complexed with gol

Details for d2ym0a1

PDB Entry: 2ym0, 3 Å

PDB Description: truncated sipd from salmonella typhimurium

PDB Compounds: (A:) Cell invasion protein sipD

SCOPe Domain Sequences for d2ym0a1:

Sequence; same for both SEQRES and ATOM records:

>d2ym0a1 a.250.1.0 (A:132-329) automated matches {Salmonella enterica [TaxId: 216597]}
aeiwdmvsqnisaigdsylgvyenvvavytdfyqafsdilskmggwllpgkdgntvkldv
tslkndlnslvnkynqinsntvlfpaqsgsgvkvateaearqwlselnlpnsclksygsg
yvvtvdltplqkmvqdidglgapgkdsklemdnakyqawqsgfkaqeenmkttlqtltqk
ysnanslydnlvkvlsst

Timeline for d2ym0a1:

• d2ym0a1 first appeared in SCOPe 2.04, called d2ym0a_
  
• d2ym0a1 appears in SCOPe 2.06
  
• d2ym0a1 appears in the current release, SCOPe 2.08