Lineage for d2ym0a_ (2ym0 A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1509408Fold a.250: IpaD-like [140692] (1 superfamily)
    6 helices; bundle, up-and-down; can be divided into two four-helical bundles sharing two helices (3 and 6), which are twice longer than the rest
  4. 1509409Superfamily a.250.1: IpaD-like [140693] (2 families) (S)
  5. 1509431Family a.250.1.0: automated matches [254281] (1 protein)
    not a true family
  6. 1509432Protein automated matches [254655] (2 species)
    not a true protein
  7. 1509433Species Salmonella enterica [TaxId:216597] [255704] (2 PDB entries)
  8. 1509434Domain d2ym0a_: 2ym0 A: [244782]
    automated match to d2jaaa1
    complexed with gol

Details for d2ym0a_

PDB Entry: 2ym0 (more details), 3 Å

PDB Description: truncated sipd from salmonella typhimurium
PDB Compounds: (A:) Cell invasion protein sipD

SCOPe Domain Sequences for d2ym0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ym0a_ a.250.1.0 (A:) automated matches {Salmonella enterica [TaxId: 216597]}
maeiwdmvsqnisaigdsylgvyenvvavytdfyqafsdilskmggwllpgkdgntvkld
vtslkndlnslvnkynqinsntvlfpaqsgsgvkvateaearqwlselnlpnsclksygs
gyvvtvdltplqkmvqdidglgapgkdsklemdnakyqawqsgfkaqeenmkttlqtltq
kysnanslydnlvkvlsst

SCOPe Domain Coordinates for d2ym0a_:

Click to download the PDB-style file with coordinates for d2ym0a_.
(The format of our PDB-style files is described here.)

Timeline for d2ym0a_: