SCOPe 2.04: Domain d2ylna_: 2yln A:

Lineage for d2ylna_ (2yln A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (87 species)
   not a true protein

7. Species Neisseria gonorrhoeae [TaxId:485] [255703] (2 PDB entries)

8. Domain d2ylna_: 2yln A: [244781]
   automated match to d3vv5b_
   complexed with cys, gol, so4

Details for d2ylna_

PDB Entry: 2yln, 1.12 Å

PDB Description: Crystal structure of the L-cystine solute receptor of Neisseria gonorrhoeae in the closed conformation

PDB Compounds: (A:) putative abc transporter, periplasmic binding protein, amino acid

SCOPe Domain Sequences for d2ylna_:

Sequence; same for both SEQRES and ATOM records:

>d2ylna_ c.94.1.0 (A:) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
aisgslierinnkgtvtvgtegtyapftyhdkdgkltgydvevtravaeklgvkvefket
qwdsmmaglkagrfdvvanqvgltsperqatfdksepyswsgavlvahndsniksiadik
gvktaqsltsnygekakaagaqlvpvdglaqsltlieqkradatlndelavldylkknpn
agvkivwsapadekvgsglivnkgndeavakfstainelkadgtlkklgeqffgkdisvq

Timeline for d2ylna_:

• d2ylna_ is new in SCOPe 2.04-stable
  
• d2ylna_ appears in SCOPe 2.05
  
• d2ylna_ appears in the current release, SCOPe 2.08