Lineage for d2yjpc_ (2yjp C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2915716Species Neisseria gonorrhoeae [TaxId:242231] [255702] (1 PDB entry)
  8. 2915719Domain d2yjpc_: 2yjp C: [244780]
    automated match to d1xt8b_
    complexed with cys, edo, zn

Details for d2yjpc_

PDB Entry: 2yjp (more details), 2.26 Å

PDB Description: Crystal structure of the solute receptors for L-cysteine of Neisseria gonorrhoeae
PDB Compounds: (C:) putative abc transporter, periplasmic binding protein, amino acid

SCOPe Domain Sequences for d2yjpc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yjpc_ c.94.1.0 (C:) automated matches {Neisseria gonorrhoeae [TaxId: 242231]}
atvaaikekgvirigvfgdkppfgyvdangknqgfdveiakdlakdllgspdkvefvlte
aanrveyvrsgkvdlilanftqtperaeavdfadpymkvalgvvspknkpitdmaqlkdq
tllvnkgttadafftkshpevkllkfdqntetfdalkdgrgvalahdnallwawakenpn
fevaignlgpaefiapavqkgnadllnwvngeiaamkkdgrlkaayektllpvygekvkp
eallae

SCOPe Domain Coordinates for d2yjpc_:

Click to download the PDB-style file with coordinates for d2yjpc_.
(The format of our PDB-style files is described here.)

Timeline for d2yjpc_: