SCOPe 2.07: Domain d2yjpb_: 2yjp B:

Lineage for d2yjpb_ (2yjp B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (158 species)
   not a true protein

7. Species Neisseria gonorrhoeae [TaxId:242231] [255702] (1 PDB entry)

8. Domain d2yjpb_: 2yjp B: [244779]
   automated match to d1xt8b_
   complexed with cys, edo, zn

Details for d2yjpb_

PDB Entry: 2yjp, 2.26 Å

PDB Description: Crystal structure of the solute receptors for L-cysteine of Neisseria gonorrhoeae

PDB Compounds: (B:) putative abc transporter, periplasmic binding protein, amino acid

SCOPe Domain Sequences for d2yjpb_:

Sequence; same for both SEQRES and ATOM records:

>d2yjpb_ c.94.1.0 (B:) automated matches {Neisseria gonorrhoeae [TaxId: 242231]}
atvaaikekgvirigvfgdkppfgyvdangknqgfdveiakdlakdllgspdkvefvlte
aanrveyvrsgkvdlilanftqtperaeavdfadpymkvalgvvspknkpitdmaqlkdq
tllvnkgttadafftkshpevkllkfdqntetfdalkdgrgvalahdnallwawakenpn
fevaignlgpaefiapavqkgnadllnwvngeiaamkkdgrlkaayektllpvygekvkp
eallae

Timeline for d2yjpb_:

• d2yjpb_ first appeared in SCOPe 2.04
  
• d2yjpb_ appears in SCOPe 2.06
  
• d2yjpb_ appears in the current release, SCOPe 2.08