SCOPe 2.08: Domain d2yjha1: 2yjh A:1-164

Lineage for d2yjha1 (2yjh A:1-164)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Yersinia pseudotuberculosis [TaxId:633] [255701] (1 PDB entry)

8. Domain d2yjha1: 2yjh A:1-164 [244777]
   Other proteins in same PDB: d2yjha2
   automated match to d3p7xa_
   mutant

Details for d2yjha1

PDB Entry: 2yjh, 2.55 Å

PDB Description: thiol peroxidase from yersinia psuedotuberculosis, inactive mutant c61s

PDB Compounds: (A:) Thiol Peroxidase

SCOPe Domain Sequences for d2yjha1:

Sequence; same for both SEQRES and ATOM records:

>d2yjha1 c.47.1.0 (A:1-164) automated matches {Yersinia pseudotuberculosis [TaxId: 633]}
mtqtvhfqgnpvsvagklpqigdkakdftlvakdlsdvalssfagkrkvlnifpsidtgv
saasvrkfnqlagelentvvlcissdlpfaqsrfcgaeglsnvitlstlrgadfkqaygv
aitegplagltaravvvldgqdnviyselvneittepnydaala

Timeline for d2yjha1:

• d2yjha1 first appeared in SCOPe 2.04, called d2yjha_
  
• d2yjha1 appears in SCOPe 2.07