Lineage for d2yjeb2 (2yje B:147-371)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2491251Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2491727Protein automated matches [226905] (13 species)
    not a true protein
  7. 2491983Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225126] (15 PDB entries)
  8. 2492001Domain d2yjeb2: 2yje B:147-371 [244774]
    Other proteins in same PDB: d2yjeb1, d2yjec1
    automated match to d1c0fa2
    complexed with atp, lab, mg

Details for d2yjeb2

PDB Entry: 2yje (more details), 3.1 Å

PDB Description: oligomeric assembly of actin bound to mrtf-a
PDB Compounds: (B:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d2yjeb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yjeb2 c.55.1.1 (B:147-371) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivh

SCOPe Domain Coordinates for d2yjeb2:

Click to download the PDB-style file with coordinates for d2yjeb2.
(The format of our PDB-style files is described here.)

Timeline for d2yjeb2: