![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds) |
![]() | Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
![]() | Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) ![]() "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
![]() | Family e.8.1.0: automated matches [227142] (1 protein) not a true family |
![]() | Protein automated matches [226844] (7 species) not a true protein |
![]() | Species Infectious pancreatic necrosis virus [TaxId:11002] [226177] (4 PDB entries) |
![]() | Domain d2yiaa1: 2yia A:3-790 [244761] Other proteins in same PDB: d2yiaa2, d2yiab2, d2yiac2, d2yiad2, d2yiae2, d2yiaf2, d2yiag2, d2yiah2 automated match to d2yi9a_ complexed with k |
PDB Entry: 2yia (more details), 3.02 Å
SCOPe Domain Sequences for d2yiaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yiaa1 e.8.1.0 (A:3-790) automated matches {Infectious pancreatic necrosis virus [TaxId: 11002]} difnspqnkasiltalmksttgdvedvlipkrfrpakdpldspqaaaqflkdnkyrilrp raiptmveletdaalprlrqmvedgklkdtvsvpegttafypkyypfhkpdhdevgtfga pditllkqltffllendfptgpetlrqvreaiatlqygsgsysgqlnrllamkgvatgrn pnktpktvgytneqlaklleqtlpintpkhedpdlrwapswlinytgdlstdksylphvt ikssaglpyigktkgdttaealvladsfirdlgraatsadpeagvkktitdfwylscgll fpkgerytqvdwdkktrniwsapypthlllsmvstpvmnesklnitntqtpslygfspfh ggmdrimtiirdsldndedlvmiyadniyilqdntwysidlekgeanctpqhmqammyyl ltrgwtnedgsprynptwatfamnvapsmvvdsscllmnlqlktygqgsgnaftflnnhl mstivvaewvkagkpnpmtkefmdleektginfkierelknlretiveavetapqdgyla dgsdlppirpgkaveldllgwsaiysrqmemfvpvlenerliasaaypkglenkalarkp gaeiayqivryeairlvggwnnplletaakhmsldkrkrlevkgidvtgflddwnnmsef ggdlegitlsepltnqtlvdintpldsfdpkarpqtprspkktldevttaitsgtykdpk savwrlldqrtklrvstlrdqalalkpasssvdnwaeateelaqqqqllmkannllkssl tetreale
Timeline for d2yiaa1: