Lineage for d1abqa_ (1abq A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2392486Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2392487Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2392491Protein Abl tyrosine kinase, SH3 domain [50052] (2 species)
  7. 2392502Species Mouse (Mus musculus) [TaxId:10090] [50053] (3 PDB entries)
  8. 2392506Domain d1abqa_: 1abq A: [24476]

Details for d1abqa_

PDB Entry: 1abq (more details), 2.8 Å

PDB Description: crystal structure of the unliganded abl tyrosine kinase sh3 domain
PDB Compounds: (A:) abl tyrosine kinase src-homology 3 (sh3) domain

SCOPe Domain Sequences for d1abqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1abqa_ b.34.2.1 (A:) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]}
lfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpvn

SCOPe Domain Coordinates for d1abqa_:

Click to download the PDB-style file with coordinates for d1abqa_.
(The format of our PDB-style files is described here.)

Timeline for d1abqa_: