Lineage for d1aboa_ (1abo A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58264Fold b.34: SH3-like barrel [50036] (9 superfamilies)
  4. 58293Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 58294Family b.34.2.1: SH3-domain [50045] (18 proteins)
  6. 58298Protein Abl tyrosine kinase, SH3 domain [50052] (2 species)
  7. 58306Species Mouse (Mus musculus) [TaxId:10090] [50053] (2 PDB entries)
  8. 58307Domain d1aboa_: 1abo A: [24474]

Details for d1aboa_

PDB Entry: 1abo (more details), 2 Å

PDB Description: crystal structure of the complex of the abl tyrosine kinase sh3 domain with 3bp-1 synthetic peptide

SCOP Domain Sequences for d1aboa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aboa_ b.34.2.1 (A:) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus)}
nlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpvns

SCOP Domain Coordinates for d1aboa_:

Click to download the PDB-style file with coordinates for d1aboa_.
(The format of our PDB-style files is described here.)

Timeline for d1aboa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1abob_