SCOPe 2.08: Domain d2yd1a2: 2yd1 A:131-229

Lineage for d2yd1a2 (2yd1 A:131-229)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [255699] (2 PDB entries)

8. Domain d2yd1a2: 2yd1 A:131-229 [244731]
   automated match to d2v9ta_
   complexed with gly

Details for d2yd1a2

PDB Entry: 2yd1, 1.8 Å

PDB Description: crystal structure of the n-terminal ig1-2 module of drosophila receptor protein tyrosine phosphatase dlar

PDB Compounds: (A:) Tyrosine-protein phosphatase Lar

SCOPe Domain Sequences for d2yd1a2:

Sequence; same for both SEQRES and ATOM records:

>d2yd1a2 b.1.1.0 (A:131-229) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
egdktpagfpvitqgpgtrvievghtvlmtckaignptpniywiknqtkvdmsnpryslk
dgflqiensreedqgkyecvaensmgtehskatnlyvkv

Timeline for d2yd1a2:

• d2yd1a2 first appeared in SCOPe 2.04
  
• d2yd1a2 appears in SCOPe 2.07