Lineage for d2yd1a2 (2yd1 A:131-229)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754257Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [255699] (2 PDB entries)
  8. 2754259Domain d2yd1a2: 2yd1 A:131-229 [244731]
    automated match to d2v9ta_
    complexed with gly

Details for d2yd1a2

PDB Entry: 2yd1 (more details), 1.8 Å

PDB Description: crystal structure of the n-terminal ig1-2 module of drosophila receptor protein tyrosine phosphatase dlar
PDB Compounds: (A:) Tyrosine-protein phosphatase Lar

SCOPe Domain Sequences for d2yd1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yd1a2 b.1.1.0 (A:131-229) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
egdktpagfpvitqgpgtrvievghtvlmtckaignptpniywiknqtkvdmsnpryslk
dgflqiensreedqgkyecvaensmgtehskatnlyvkv

SCOPe Domain Coordinates for d2yd1a2:

Click to download the PDB-style file with coordinates for d2yd1a2.
(The format of our PDB-style files is described here.)

Timeline for d2yd1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2yd1a1