Lineage for d2yd0a3 (2yd0 A:530-614)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2766973Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) (S)
    same topology as (b.1.15.1)
  5. 2766974Family b.1.30.1: Zn aminopeptidase insert domain [254169] (3 proteins)
  6. 2766986Protein ERAP1 insert domain [254384] (1 species)
  7. 2766987Species Human (Homo sapiens) [TaxId:9606] [254817] (2 PDB entries)
  8. 2766989Domain d2yd0a3: 2yd0 A:530-614 [244728]
    Other proteins in same PDB: d2yd0a1, d2yd0a2, d2yd0a4
    complexed with bes, edo, k, nag, zn

Details for d2yd0a3

PDB Entry: 2yd0 (more details), 2.7 Å

PDB Description: crystal structure of the soluble domain of human endoplasmic reticulum aminopeptidase 1 erap1
PDB Compounds: (A:) endoplasmic reticulum aminopeptidase 1

SCOPe Domain Sequences for d2yd0a3:

Sequence, based on SEQRES records: (download)

>d2yd0a3 b.1.30.1 (A:530-614) ERAP1 insert domain {Human (Homo sapiens) [TaxId: 9606]}
fplititvrgrnvhmkqehymkgsdgapdtgylwhvpltfitsksdmvhrfllktktdvl
ilpeevewikfnvgmngyyivhyed

Sequence, based on observed residues (ATOM records): (download)

>d2yd0a3 b.1.30.1 (A:530-614) ERAP1 insert domain {Human (Homo sapiens) [TaxId: 9606]}
fplititvrgrnvhmkqehymkgdtgylwhvpltfitsksdmvhrfllktktdvlilpee
vewikfnvgmngyyivhyed

SCOPe Domain Coordinates for d2yd0a3:

Click to download the PDB-style file with coordinates for d2yd0a3.
(The format of our PDB-style files is described here.)

Timeline for d2yd0a3: