Lineage for d2yd0a2 (2yd0 A:255-529)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1660634Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1660635Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1661524Family d.92.1.13: Zn aminopeptidase catalytic domain [64338] (4 proteins)
    adopts thermolysin-like fold
  6. 1661534Protein ERAP1 catalytic domain [254382] (1 species)
  7. 1661535Species Human (Homo sapiens) [TaxId:9606] [254815] (1 PDB entry)
  8. 1661536Domain d2yd0a2: 2yd0 A:255-529 [244727]
    Other proteins in same PDB: d2yd0a1, d2yd0a3, d2yd0a4
    complexed with bes, edo, k, nag, zn

Details for d2yd0a2

PDB Entry: 2yd0 (more details), 2.7 Å

PDB Description: crystal structure of the soluble domain of human endoplasmic reticulum aminopeptidase 1 erap1
PDB Compounds: (A:) endoplasmic reticulum aminopeptidase 1

SCOPe Domain Sequences for d2yd0a2:

Sequence, based on SEQRES records: (download)

>d2yd0a2 d.92.1.13 (A:255-529) ERAP1 catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
esvskitksgvkvsvyavpdkinqadyaldaavtllefyedyfsipyplpkqdlaaipdf
qsgamenwglttyresallfdaekssassklgitmtvahelahqwfgnlvtmewwndlwl
negfakfmefvsvsvthpelkvgdyffgkcfdamevdalnsshpvstpvenpaqiremfd
dvsydkgacilnmlreylsadafksgivqylqkhsykntknedlwdsmasicptdgvkgm
dgfcsrsqhssssshwhqegvdvktmmntwtlqkg

Sequence, based on observed residues (ATOM records): (download)

>d2yd0a2 d.92.1.13 (A:255-529) ERAP1 catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
esvskitksgvkvsvyavpdkinqadyaldaavtllefyedyfsipyplpkqdlaaipdf
qsgamenwglttyresallfdaekssassklgitmtvahelahqwfgnlvtmewwndlwl
negfakfmefvsvsvthpelkvgdyffgkcfdamevdalnsshpvstpvenpaqiremfd
dvsydkgacilnmlreylsadafksgivqylqkhsykntknedlwdsmasigvdvktmmn
twtlqkg

SCOPe Domain Coordinates for d2yd0a2:

Click to download the PDB-style file with coordinates for d2yd0a2.
(The format of our PDB-style files is described here.)

Timeline for d2yd0a2: