Lineage for d2ybqa_ (2ybq A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142835Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 5 strands, order 32415
    Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest
  4. 2142836Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) (S)
  5. 2143052Family c.90.1.0: automated matches [191315] (1 protein)
    not a true family
  6. 2143053Protein automated matches [190076] (5 species)
    not a true protein
  7. 2143056Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [255697] (2 PDB entries)
  8. 2143057Domain d2ybqa_: 2ybq A: [244723]
    automated match to d1va0b_
    complexed with sah, up2

Details for d2ybqa_

PDB Entry: 2ybq (more details), 2 Å

PDB Description: the x-ray structure of the sam-dependent uroporphyrinogen iii methyltransferase nire from pseudomonas aeruginosa in complex with sah and uroporphyrinogen iii
PDB Compounds: (A:) Methyltransferase

SCOPe Domain Sequences for d2ybqa_:

Sequence, based on SEQRES records: (download)

>d2ybqa_ c.90.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
vdfpagsvalvgagpgdpglltlrawallqqaevvvydrlvareliallpescqriyvgk
rcghhslpqeeinellvrlarqqrrvvrlkggdpfifgrgaeelerlleagvdcqvvpgv
taasgcstyagiplthrdlaqsctfvtghlqndgrldldwaglargkqtlvfymglgnla
eiaarlvehglasdtpaalvsqgtqagqqvtrgalaelpalarryqlkpptlivvgqvva
lfaeramahpsylg

Sequence, based on observed residues (ATOM records): (download)

>d2ybqa_ c.90.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
vdfpagsvalvgagpgdpglltlrawallqqaevvvydrlvareliallpescqriyvgp
qeeinellvrlarqqrrvvrlkggdpfifgrgaeelerlleagvdcqvvpgvtaasgcst
yagiplthrdlaqsctfvtghlqldldwaglargkqtlvfymglgnlaeiaarlvehgla
sdtpaalvsqgtqagqqvtrgalaelpalarryqlkpptlivvgqvvalfaeramahpsy
lg

SCOPe Domain Coordinates for d2ybqa_:

Click to download the PDB-style file with coordinates for d2ybqa_.
(The format of our PDB-style files is described here.)

Timeline for d2ybqa_: