Lineage for d1neba_ (1neb A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1783415Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1783416Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 1783748Protein SH3 domain from nebulin [50050] (1 species)
  7. 1783749Species Human (Homo sapiens) [TaxId:9606] [50051] (2 PDB entries)
  8. 1783750Domain d1neba_: 1neb A: [24472]

Details for d1neba_

PDB Entry: 1neb (more details)

PDB Description: sh3 domain from human nebulin, nmr, minimized average structure
PDB Compounds: (A:) nebulin

SCOPe Domain Sequences for d1neba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1neba_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]}
tagkiframydymaadadevsfkdgdaiinvqaidegwmygtvqrtgrtgmlpanyveai

SCOPe Domain Coordinates for d1neba_:

Click to download the PDB-style file with coordinates for d1neba_.
(The format of our PDB-style files is described here.)

Timeline for d1neba_: