Lineage for d1neb__ (1neb -)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58264Fold b.34: SH3-like barrel [50036] (9 superfamilies)
  4. 58293Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 58294Family b.34.2.1: SH3-domain [50045] (18 proteins)
  6. 58439Protein SH3 domain from nebulin [50050] (1 species)
  7. 58440Species Human (Homo sapiens) [TaxId:9606] [50051] (2 PDB entries)
  8. 58441Domain d1neb__: 1neb - [24472]

Details for d1neb__

PDB Entry: 1neb (more details)

PDB Description: sh3 domain from human nebulin, nmr, minimized average structure

SCOP Domain Sequences for d1neb__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1neb__ b.34.2.1 (-) SH3 domain from nebulin {Human (Homo sapiens)}
tagkiframydymaadadevsfkdgdaiinvqaidegwmygtvqrtgrtgmlpanyveai

SCOP Domain Coordinates for d1neb__:

Click to download the PDB-style file with coordinates for d1neb__.
(The format of our PDB-style files is described here.)

Timeline for d1neb__: