SCOPe 2.07: Domain d2yaba_: 2yab A:

Lineage for d2yaba_ (2yab A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (20 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187169] (41 PDB entries)

8. Domain d2yaba_: 2yab A: [244718]
   automated match to d2x0ga_
   complexed with amp, ca, so4

Details for d2yaba_

PDB Entry: 2yab, 1.9 Å

PDB Description: crystal structure of the autoinhibited form of mouse dapk2 in complex with amp

PDB Compounds: (A:) Death-associated protein kinase 2

SCOPe Domain Sequences for d2yaba_:

Sequence; same for both SEQRES and ATOM records:

>d2yaba_ d.144.1.7 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvcreeie
revsilrqvlhpniitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsfikq
ildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifgtpe
fvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdeeffs
qtselakdfirkllvketrkrltiqealrhpwitpvdtqqamvrresvvnlenfkkqyv

Timeline for d2yaba_:

• d2yaba_ first appeared in SCOPe 2.04
  
• d2yaba_ appears in SCOPe 2.06
  
• d2yaba_ appears in the current release, SCOPe 2.08