Lineage for d2yaba_ (2yab A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671717Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1671718Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1671838Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1673984Protein automated matches [190091] (13 species)
    not a true protein
  7. 1674741Species Mouse (Mus musculus) [TaxId:10090] [187169] (34 PDB entries)
  8. 1674772Domain d2yaba_: 2yab A: [244718]
    automated match to d2x0ga_
    complexed with amp, ca, so4

Details for d2yaba_

PDB Entry: 2yab (more details), 1.9 Å

PDB Description: crystal structure of the autoinhibited form of mouse dapk2 in complex with amp
PDB Compounds: (A:) Death-associated protein kinase 2

SCOPe Domain Sequences for d2yaba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yaba_ d.144.1.7 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvcreeie
revsilrqvlhpniitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsfikq
ildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifgtpe
fvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdeeffs
qtselakdfirkllvketrkrltiqealrhpwitpvdtqqamvrresvvnlenfkkqyv

SCOPe Domain Coordinates for d2yaba_:

Click to download the PDB-style file with coordinates for d2yaba_.
(The format of our PDB-style files is described here.)

Timeline for d2yaba_: