Lineage for d2yaab_ (2yaa B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2983276Protein automated matches [190091] (20 species)
    not a true protein
  7. 2984616Species Mouse (Mus musculus) [TaxId:10090] [187169] (30 PDB entries)
  8. 2984656Domain d2yaab_: 2yaa B: [244717]
    automated match to d2x0ga_
    complexed with atp, ca, so4

Details for d2yaab_

PDB Entry: 2yaa (more details), 2.3 Å

PDB Description: crystal structure of the autoinhibited form of mouse dapk2 in complex with atp
PDB Compounds: (B:) Death-associated protein kinase 2

SCOPe Domain Sequences for d2yaab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yaab_ d.144.1.7 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvcreeie
revsilrqvlhpniitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsfikq
ildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifgtpe
fvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdeeffs
qtselakdfirkllvketrkrltiqealrhpwitpvdtqqamvrresvvnlenfkkqyv

SCOPe Domain Coordinates for d2yaab_:

Click to download the PDB-style file with coordinates for d2yaab_.
(The format of our PDB-style files is described here.)

Timeline for d2yaab_: