Lineage for d2yaaa_ (2yaa A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2220941Protein automated matches [190091] (17 species)
    not a true protein
  7. 2221953Species Mouse (Mus musculus) [TaxId:10090] [187169] (38 PDB entries)
  8. 2221996Domain d2yaaa_: 2yaa A: [244716]
    automated match to d2x0ga_
    complexed with atp, ca, so4

Details for d2yaaa_

PDB Entry: 2yaa (more details), 2.3 Å

PDB Description: crystal structure of the autoinhibited form of mouse dapk2 in complex with atp
PDB Compounds: (A:) Death-associated protein kinase 2

SCOPe Domain Sequences for d2yaaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yaaa_ d.144.1.7 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
etfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvcreei
erevsilrqvlhpniitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsfik
qildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifgtp
efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdeeff
sqtselakdfirkllvketrkrltiqealrhpwitpvdtqqamvrresvvnlenfkkqyv

SCOPe Domain Coordinates for d2yaaa_:

Click to download the PDB-style file with coordinates for d2yaaa_.
(The format of our PDB-style files is described here.)

Timeline for d2yaaa_: