SCOPe 2.07: Domain d2y9ta1: 2y9t A:543-622

Lineage for d2y9ta1 (2y9t A:543-622)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.0: automated matches [191306] (1 protein)
   not a true family

6. Protein automated matches [190031] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188353] (22 PDB entries)

8. Domain d2y9ta1: 2y9t A:543-622 [244713]
   Other proteins in same PDB: d2y9ta2
   automated match to d1coka_
   mutant

Details for d2y9ta1

PDB Entry: 2y9t

PDB Description: structural basis of p63a sam domain mutants involved in aec syndrome

PDB Compounds: (A:) Tumor protein 63

SCOPe Domain Sequences for d2y9ta1:

Sequence; same for both SEQRES and ATOM records:

>d2y9ta1 a.60.1.0 (A:543-622) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yptdcsivsflarlgcsscldyfttqglttiyqiehysmddlaslkipeqfrhaiwkgil
dhrqlhefsspshllrtpss

Timeline for d2y9ta1:

• d2y9ta1 first appeared in SCOPe 2.04, called d2y9ta_
  
• d2y9ta1 appears in SCOPe 2.06