Lineage for d2y96a_ (2y96 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2875105Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2875106Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2875762Family c.45.1.0: automated matches [191381] (1 protein)
    not a true family
  6. 2875763Protein automated matches [190475] (10 species)
    not a true protein
  7. 2875775Species Human (Homo sapiens) [TaxId:9606] [187400] (140 PDB entries)
  8. 2875875Domain d2y96a_: 2y96 A: [244711]
    automated match to d1vhra_
    complexed with so4

Details for d2y96a_

PDB Entry: 2y96 (more details), 2.38 Å

PDB Description: structure of human dual-specificity phosphatase 27
PDB Compounds: (A:) dual specificity phosphatase dupd1

SCOPe Domain Sequences for d2y96a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y96a_ c.45.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dyctpgafelerlfwkgspqythvnevwpklyigdeataldryrlqkagfthvlnaahgr
wnvdtgpdyyrdmdiqyhgveaddlptfdlsvffypaaafidralsddhskilvhcvmgr
srsatlvlaylmihkdmtlvdaiqqvaknrcvlpnrgflkqlreldkqlvqqrrr

SCOPe Domain Coordinates for d2y96a_:

Click to download the PDB-style file with coordinates for d2y96a_.
(The format of our PDB-style files is described here.)

Timeline for d2y96a_: