Lineage for d2y34a_ (2y34 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1558339Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1559062Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 1559412Family b.82.2.15: proly-4-hydroxylase (P4H, PHD) like [254173] (3 proteins)
    Pfam PF13640; PubMed 16782814
  6. 1559420Protein automated matches [254532] (2 species)
    not a true protein
  7. 1559428Species Human (Homo sapiens) [TaxId:9606] [255179] (13 PDB entries)
  8. 1559436Domain d2y34a_: 2y34 A: [244696]
    automated match to d2g19a_
    complexed with fe2, un9

Details for d2y34a_

PDB Entry: 2y34 (more details), 2.01 Å

PDB Description: s-nitrosylated phd2 (no exposed) in complex with fe(ii) and un9
PDB Compounds: (A:) Egl nine homolog 1

SCOPe Domain Sequences for d2y34a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y34a_ b.82.2.15 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
plpalklaleyivpcmnkhgicvvddflgketgqqigdevralhdtgkftdgqlvsqksd
sskdirgdkitwiegkepgcetigllmssmddlirhcngklgsykingrtkamvacypgn
gtgyvrhvdnpngdgrcvtciyylnkdwdakvsggilrifpegkaqfadiepkfdrllff
wsdrrnphevqpayatryaitvwyfdaderarakvk

SCOPe Domain Coordinates for d2y34a_:

Click to download the PDB-style file with coordinates for d2y34a_.
(The format of our PDB-style files is described here.)

Timeline for d2y34a_: