| Class b: All beta proteins [48724] (180 folds) |
| Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) ![]() Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
| Family b.82.2.15: proly-4-hydroxylase (P4H, PHD) like [254173] (3 proteins) Pfam PF13640; PubMed 16782814 |
| Protein automated matches [254532] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [255179] (35 PDB entries) |
| Domain d2y34a_: 2y34 A: [244696] automated match to d2g19a_ complexed with fe2, un9 |
PDB Entry: 2y34 (more details), 2.01 Å
SCOPe Domain Sequences for d2y34a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y34a_ b.82.2.15 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
plpalklaleyivpcmnkhgicvvddflgketgqqigdevralhdtgkftdgqlvsqksd
sskdirgdkitwiegkepgcetigllmssmddlirhcngklgsykingrtkamvacypgn
gtgyvrhvdnpngdgrcvtciyylnkdwdakvsggilrifpegkaqfadiepkfdrllff
wsdrrnphevqpayatryaitvwyfdaderarakvk
Timeline for d2y34a_: