Lineage for d2xzms_ (2xzm S:)

  1. Root: SCOPe 2.04
  2. 1710350Class i: Low resolution protein structures [58117] (25 folds)
  3. 1710351Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1710352Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1711644Family i.1.1.3: Small subunit [58132] (2 proteins)
  6. 1711686Protein 40S subunit [254422] (2 species)
  7. 1711711Species Tetrahymena thermophila [TaxId:5911] [254866] (1 PDB entry)
  8. 1711738Domain d2xzms_: 2xzm S: [244687]
    complexed with mg, zn

Details for d2xzms_

PDB Entry: 2xzm (more details), 3.93 Å

PDB Description: crystal structure of the eukaryotic 40s ribosomal subunit in complex with initiation factor 1. this file contains the 40s subunit and initiation factor for molecule 1
PDB Compounds: (S:) rps15e

SCOPe Domain Sequences for d2xzms_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xzms_ i.1.1.3 (S:) 40S subunit {Tetrahymena thermophila [TaxId: 5911]}
ftfrgkgleeltalasgsnseklisdelaalfdaktrrrvkrgisekyakfvnkvrrske
kcpagekpvpvkthyrsmivipelvggivgvyngkefvnvevkfdmigkylaefamtykp
tthgk

SCOPe Domain Coordinates for d2xzms_:

Click to download the PDB-style file with coordinates for d2xzms_.
(The format of our PDB-style files is described here.)

Timeline for d2xzms_: