| Class i: Low resolution protein structures [58117] (25 folds) |
| Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
| Family i.1.1.3: Small subunit [58132] (3 proteins) |
| Protein Eukaryotic, cytoplasmic (40S subunit) [254422] (2 species) |
| Species Tetrahymena thermophila [TaxId:5911] [254866] (1 PDB entry) |
| Domain d2xzmp_: 2xzm P: [244684] Other proteins in same PDB: d2xzm62, d2xzmn2 complexed with mg, zn complexed with mg, zn |
PDB Entry: 2xzm (more details), 3.93 Å
SCOPe Domain Sequences for d2xzmp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xzmp_ i.1.1.3 (P:) Eukaryotic, cytoplasmic (40S subunit) {Tetrahymena thermophila [TaxId: 5911]}
tivirtkkilvnpllsrrqlsldvlhpdsptaskekireelakqlkvdarnvvvygfstq
ygggkstgfalvydnqqyllkyepnyrlrkvkilgekpntrrsfkelkrkikrtsgkait
kllsekkgdtwasvqskksdhlknfvak
Timeline for d2xzmp_:
View in 3DDomains from other chains: (mouse over for more information) d2xzm1_, d2xzm2_, d2xzm3_, d2xzm4_, d2xzm5_, d2xzm61, d2xzm62, d2xzm7_, d2xzm8_, d2xzm9_, d2xzmb_, d2xzmc_, d2xzmd_, d2xzme_, d2xzmf_, d2xzmg_, d2xzmh_, d2xzmi_, d2xzmj_, d2xzmk_, d2xzml_, d2xzmm_, d2xzmn1, d2xzmn2, d2xzmo_, d2xzmq_, d2xzmr_, d2xzms_, d2xzmt_, d2xzmu_, d2xzmv_, d2xzmw_, d2xzmx_, d2xzmy_, d2xzmz_ |