Lineage for d2xzmn1 (2xzm N:3-53)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2647133Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2647134Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2648718Family i.1.1.3: Small subunit [58132] (3 proteins)
  6. 2648719Protein Eukaryotic, cytoplasmic (40S subunit) [254422] (2 species)
  7. 2648744Species Tetrahymena thermophila [TaxId:5911] [254866] (1 PDB entry)
  8. 2648766Domain d2xzmn1: 2xzm N:3-53 [244682]
    Other proteins in same PDB: d2xzm62, d2xzmn2
    complexed with mg, zn
    complexed with mg, zn

Details for d2xzmn1

PDB Entry: 2xzm (more details), 3.93 Å

PDB Description: crystal structure of the eukaryotic 40s ribosomal subunit in complex with initiation factor 1. this file contains the 40s subunit and initiation factor for molecule 1
PDB Compounds: (N:) rps29e

SCOPe Domain Sequences for d2xzmn1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xzmn1 i.1.1.3 (N:3-53) Eukaryotic, cytoplasmic (40S subunit) {Tetrahymena thermophila [TaxId: 5911]}
nklwrthprnygkdskecrvcgarqglitkyemmtcrrcfreqaphigfvk

SCOPe Domain Coordinates for d2xzmn1:

Click to download the PDB-style file with coordinates for d2xzmn1.
(The format of our PDB-style files is described here.)

Timeline for d2xzmn1: