SCOPe 2.07: Domain d2xzmk_: 2xzm K:

Lineage for d2xzmk_ (2xzm K:)

1. Root: SCOPe 2.07

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.3: Small subunit [58132] (3 proteins)

6. Protein Eukaryotic, cytoplasmic (40S subunit) [254422] (2 species)

7. Species Tetrahymena thermophila [TaxId:5911] [254866] (1 PDB entry)

8. Domain d2xzmk_: 2xzm K: [244679]
   Other proteins in same PDB: d2xzm62, d2xzmn2
   complexed with mg, zn
   complexed with mg, zn

Details for d2xzmk_

PDB Entry: 2xzm, 3.93 Å

PDB Description: crystal structure of the eukaryotic 40s ribosomal subunit in complex with initiation factor 1. this file contains the 40s subunit and initiation factor for molecule 1

PDB Compounds: (K:) rps14e

SCOPe Domain Sequences for d2xzmk_:

Sequence; same for both SEQRES and ATOM records:

>d2xzmk_ i.1.1.3 (K:) Eukaryotic, cytoplasmic (40S subunit) {Tetrahymena thermophila [TaxId: 5911]}
evisygppnvganenvfgvchimatwndtfihvtdlsgretlvrvtggmkvkadreessp
yaamqaaidvvnrckelkinalhiklrakggvetkqpgpgaqsalralarsgmkigried
vtpiptdstrreggrrgrrl

Timeline for d2xzmk_:

• d2xzmk_ first appeared in SCOPe 2.04
  
• d2xzmk_ appears in SCOPe 2.06
  
• d2xzmk_ appears in the current release, SCOPe 2.08