Lineage for d2xzm8_ (2xzm 8:)

  1. Root: SCOPe 2.04
  2. 1710350Class i: Low resolution protein structures [58117] (25 folds)
  3. 1710351Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1710352Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1711644Family i.1.1.3: Small subunit [58132] (2 proteins)
  6. 1711686Protein 40S subunit [254422] (2 species)
  7. 1711711Species Tetrahymena thermophila [TaxId:5911] [254866] (1 PDB entry)
  8. 1711719Domain d2xzm8_: 2xzm 8: [244668]
    complexed with mg, zn

Details for d2xzm8_

PDB Entry: 2xzm (more details), 3.93 Å

PDB Description: crystal structure of the eukaryotic 40s ribosomal subunit in complex with initiation factor 1. this file contains the 40s subunit and initiation factor for molecule 1
PDB Compounds: (8:) rps25e,

SCOPe Domain Sequences for d2xzm8_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xzm8_ i.1.1.3 (8:) 40S subunit {Tetrahymena thermophila [TaxId: 5911]}
kkggkkkwtkgkakdkvnhavfiekknvesiinnpskvgkvltvstvveklkvngslarq
lmrtmadrklvekvakngnqwvysviggvkedk

SCOPe Domain Coordinates for d2xzm8_:

Click to download the PDB-style file with coordinates for d2xzm8_.
(The format of our PDB-style files is described here.)

Timeline for d2xzm8_: