Lineage for d2xz6c_ (2xz6 C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2084600Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2084601Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2085014Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 2085015Protein automated matches [193506] (6 species)
    not a true protein
  7. 2085046Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (48 PDB entries)
  8. 2085361Domain d2xz6c_: 2xz6 C: [244653]
    automated match to d2c9ta_
    complexed with etm; mutant

Details for d2xz6c_

PDB Entry: 2xz6 (more details), 3.14 Å

PDB Description: mtset-modified y53c mutant of aplysia achbp
PDB Compounds: (C:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d2xz6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xz6c_ b.96.1.0 (C:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvyceqqrwkl
nslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqr
lsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
rqvqhysccpepyidvnlvvkfrerr

SCOPe Domain Coordinates for d2xz6c_:

Click to download the PDB-style file with coordinates for d2xz6c_.
(The format of our PDB-style files is described here.)

Timeline for d2xz6c_: