| Class b: All beta proteins [48724] (180 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
| Protein automated matches [190824] (31 species) not a true protein |
| Species Pycnoporus cinnabarinus [TaxId:5643] [255693] (1 PDB entry) |
| Domain d2xyba3: 2xyb A:301-497 [244624] automated match to d1kyaa3 complexed with act, as8, cu, gol, na, nag, per, so4, zn |
PDB Entry: 2xyb (more details), 1.75 Å
SCOPe Domain Sequences for d2xyba3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xyba3 b.6.1.0 (A:301-497) automated matches {Pycnoporus cinnabarinus [TaxId: 5643]}
nevdlhplspmpvpgspepggvdkplnlvfnfngtnffindhtfvppsvpvllqilsgaq
aaqdlvpegsvfvlpsnssieisfpatanapgfphpfhlhghafavvrsagssvynydnp
ifrdvvstgqpgdnvtirfetnnpgpwflhchidfhldagfavvmaedtpdtkaanpvpq
awsdlcpiydaldpsdl
Timeline for d2xyba3: