Lineage for d2xyba1 (2xyb A:1-130)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2772201Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2772202Protein automated matches [190824] (31 species)
    not a true protein
  7. 2772664Species Pycnoporus cinnabarinus [TaxId:5643] [255693] (1 PDB entry)
  8. 2772665Domain d2xyba1: 2xyb A:1-130 [244622]
    automated match to d1kyaa1
    complexed with act, as8, cu, gol, na, nag, per, so4, zn

Details for d2xyba1

PDB Entry: 2xyb (more details), 1.75 Å

PDB Description: crystal structure of a fully functional laccase from the ligninolytic fungus pycnoporus cinnabarinus
PDB Compounds: (A:) laccase

SCOPe Domain Sequences for d2xyba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xyba1 b.6.1.0 (A:1-130) automated matches {Pycnoporus cinnabarinus [TaxId: 5643]}
aigpvadltltnaqvspdgfareavvvngitpaplitgnkgdrfqlnvidqltnhtmlkt
ssihwhgffqqgtnwadgpafvnqcpiasghsflydfqvpdqagtfwyhshlstqycdgl
rgpfvvydpn

SCOPe Domain Coordinates for d2xyba1:

Click to download the PDB-style file with coordinates for d2xyba1.
(The format of our PDB-style files is described here.)

Timeline for d2xyba1: